PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF045500040CFD_t1
Common NameTRAES_3BF045500040CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family WRKY
Protein Properties Length: 410aa    MW: 43601.3 Da    PI: 5.2464
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF045500040CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY98.25.3e-31177233258
                              --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
                     WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                              dDgy+WrKYGqK +k+s++prsYYrCt ++C++kk+ver+ ++p+++++tYeg H h
  TRAES3BF045500040CFD_t1 177 DDGYKWRKYGQKAIKNSPNPRSYYRCTNPRCNAKKQVERAVDEPDTLVVTYEGLHLH 233
                              8******************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081127.037171236IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.6E-28172234IPR003657WRKY domain
SuperFamilySSF1182905.1E-26174234IPR003657WRKY domain
SMARTSM007741.3E-35176235IPR003657WRKY domain
PfamPF031061.0E-24177233IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 410 aa     Download sequence    Send to blast
MEEMGEESSR YPWQDYDLGF GEELMRELLD QTTTAPTPSP AAMAAGAASA DNSSSSDKGI  60
GDEEEGAAGR RESMENRLMS TVYSGPTLSD IESALSFTGA GAGDPLDGRS KYHYSPSSPV  120
YVPRIYANNN HIQFSVDASS IWTSVWKFRV FSPEKVLGKM ENKYTMKIKS CGNGLADDGY  180
KWRKYGQKAI KNSPNPRSYY RCTNPRCNAK KQVERAVDEP DTLVVTYEGL HLHYTYSHFL  240
QQQTNPPPAA AAAASSSKKP KLHPTAGAIT VTDSHHGSTP VPTTSPPSAA VVPAGAGDSS  300
GDSGGNVTAD AGFLLEHAVP NCSPYLFDGG LLSDAGEERR MPSDAGGLLE DMVPLMVRRP  360
SCNSAATTAS SSTTLGSPPA PMSSPSPSTS SVSWTPASPY IDMAVLSNIF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A8e-211752331674Probable WRKY transcription factor 4
2lex_A8e-211752331674Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014754265.11e-97PREDICTED: WRKY transcription factor SUSIBA2-like isoform X1
TrEMBLA0A080YUJ60.0A0A080YUJ6_WHEAT; Uncharacterized protein
STRINGMLOC_7470.11e-128(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP75253551
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43290.13e-39WRKY DNA-binding protein 49
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]